Get Newsletter
Alzheimer Research Forum - Networking for a Cure Alzheimer Research Forum - Networking for a CureAlzheimer Research Forum - Networking for a Cure
  
What's New HomeContact UsHow to CiteGet NewsletterBecome a MemberLogin          
Papers of the Week
Current Papers
ARF Recommends
Milestone Papers
Search All Papers
Search Comments
News
Research News
Drug News
Conference News
Research
AD Hypotheses
  AlzSWAN
  Current Hypotheses
  Hypothesis Factory
Forums
  Live Discussions
  Virtual Conferences
  Interviews
Enabling Technologies
  Workshops
  Research Tools
Compendia
  AlzGene
  AlzRisk
  Antibodies
  Biomarkers
  Mutations
  Protocols
  Research Models
  Video Gallery
Resources
  Bulletin Boards
  Conference Calendar
  Grants
  Jobs
Early-Onset Familial AD
Overview
Diagnosis/Genetics
Research
News
Profiles
Clinics
Drug Development
Companies
Tutorial
Drugs in Clinical Trials
Disease Management
About Alzheimer's
  FAQs
Diagnosis
  Clinical Guidelines
  Tests
  Brain Banks
Treatment
  Drugs and Therapies
Caregiving
  Patient Care
  Support Directory
  AD Experiences
Community
Member Directory
Researcher Profiles
Institutes and Labs
About the Site
Mission
ARF Team
ARF Awards
Advisory Board
Sponsors
Partnerships
Fan Mail
Support Us
Return to Top
Home: Papers of the Week
Annotation


Zhou S, Zhou H, Walian PJ, Jap BK. CD147 is a regulatory subunit of the gamma-secretase complex in Alzheimer's disease amyloid beta-peptide production. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7499-504. PubMed Abstract

Comments on Paper and Primary News
  Comment by:  Todd E. Golde
Submitted 17 May 2005  |  Permalink Posted 17 May 2005

The recent manuscript by Zhou et al. clearly shows that CD147 co-purifies with the γ-secretase complex. However, the claim that it is a novel regulatory subunit of the complex is likely to be debated. CD147 is a type 1 membrane protein that is in the IgG superfamily. Its ectodomain can be shed, and its juxtamembrane region (QAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK; transmembrane region in bold) resembles many known substrates that are cleaved by γ-secretase. As APP carboxyl-terminal fragments have been shown to co-purify with γ-secretase, there is precedent that substrate can associate with the complex. This has led to the proposal by Michael Wolfe and colleagues that γ-secretase has a docking site that is distinct from its active site. CD147 as a γ-secretase substrate can explain most of the observations in the manuscript. CD147 might compete for cleavage of other substrates; thus, downregulating CD147 could increase cleavage by other substrates. Indeed, under certain circumstances, γ-secretase substrates can compete for cleavage. In any case, I think experiments to examine...  Read more

  Comment by:  Gopal Thinakaran, Huaxi Xu
Submitted 18 May 2005  |  Permalink Posted 18 May 2005

This interesting report by Zhou et al. suggests that intramembranous cleavage of APP by γ-secretase is negatively regulated by a cell surface type I membrane protein, termed CD147/basigin/EMMPRIN, which belongs to the immunoglobulin superfamily. The authors identified CD147 as a subunit of the γ-secretase complex, based on its coelution with native γ-secretase complex during chromatographic purification from HeLa cells. Two important features of CD147 indicate that it is a regulatory subunit, and not one of the core components (such as PS1, nicastrin, APH-1 and PEN2), of the γ-secretase complex. First, siRNA-mediated CD147 knockdown studies using CHO cells caused a modest increase in the levels of secreted Aβ40 and Aβ42 peptides. Second, CD147 depletion had no effect on the stability of the γ-secretase complex components. In contrast to the behavior of CD147, absence or depletion of any one of the core components destabilizes the other mature components and leads to invariable loss of Aβ production.

While the findings in this report are intriguing, certain aspects of the...  Read more


  Comment by:  Mary Reid
Submitted 22 May 2005  |  Permalink Posted 25 May 2005

Malaguarnera et al. report a possible link with Helicobacter pylori and Alzheimer disease.

Might we suspect molecular mimicry at play here? Helicobacter pylori may express the Lewis X antigen. Would you expect that an immune reaction may also be directed to CD147?

Fan et al. report that the expression of basigin (CD147) correlates with the expression of LeX antigen and fucosyltransferase IV.

Is it a coincidence that amyloidosis may occur during the course of a Schistosoma mansoni infection? An immune response is raised against LeX during this infection.

Gray et al. report an association with cerebral amyloid angiopathy and granulomatous angiitis, and suggest that granulomatous angiitis may represent a foreign-body reaction to A4 amyloid deposition. Would you expect neuroschistosomiasis may be associated with amyloid deposits which have occurred due to an antigenic response to LeX and subsequently reduced CD147?

References:
Malaguarnera M, Bella R, Alagona G, Ferri R, Carnemolla A, Pennisi G. Helicobacter pylori and Alzheimer's...  Read more

  Submit a Comment on this Paper
Cast your vote and/or make a comment on this paper. 

If you already are a member, please login.
Not sure if you are a member? Search our member database.

*First Name  
*Last Name  
Country or Territory:
*Login Email Address  
*Password    Minimum of 8 characters
*Confirm Password  
Stay signed in?  

I recommend this paper

Comment:

(If coauthors exist for this comment, please enter their names and email addresses at the end of the comment.)

References:


*Enter the verification code you see in the picture below:


This helps Alzforum prevent automated registrations.

Terms and Conditions of Use:Printable Version

By clicking on the 'I accept' below, you are agreeing to the Terms and Conditions of Use above.
 
 
Print this page
Email this page
Alzforum News
Papers of the Week
Text size
Share & Bookmark
Desperately

Antibodies
Cell Lines
Collaborators
Papers
Research Participants
Copyright © 1996-2013 Alzheimer Research Forum Terms of Use How to Cite Privacy Policy Disclaimer Disclosure Copyright
wma logoadadad